Gene/Proteome Database (LMPD)

LMPD ID
LMP014095
Gene ID
719324
Species
Macaca mulatta (Rhesus monkey)
Gene Name
Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
Gene Symbol
FCER1A
Alternate Names
Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide;
Chromosome
1
Map Location
chromosome:1

Proteins

Refseq ID XP_001117218
Protein GI 297280404
UniProt ID F6YWM7
mRNA ID XM_001117218
Length 260
MKKMAPAMESPTLLCVALLFFAPDGVLAVPQKPTVSLNPPWNRIFKGENVTLTCNGSNFFEVSSMKWFHNGSLSEVANSSLNIVNADFEDSGEYKCQHQQFDDSEPVHLEVFSDWLLLQASAEVVMEGQPLFLRCHSWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKLWQLDCESEPLNITVIKAQHDKYWLQFLIPLLVAILFAVDTGLFISTQQQVTFLLKIKRTRKGFKLLNPHPKPNPKSN

Gene Information

Entrez Gene ID
719324
Gene Name
Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
Gene Symbol
FCER1A
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009897 IEA:Ensembl C external side of plasma membrane
GO:0005887 IEA:Ensembl C integral component of plasma membrane
GO:0019767 IEA:Ensembl F IgE receptor activity
GO:0007257 IEA:Ensembl P activation of JUN kinase activity
GO:0019370 IEA:Ensembl P leukotriene biosynthetic process
GO:0050850 IEA:Ensembl P positive regulation of calcium-mediated signaling
GO:0045425 IEA:Ensembl P positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process
GO:0045401 IEA:Ensembl P positive regulation of interleukin-3 biosynthetic process
GO:0043306 IEA:Ensembl P positive regulation of mast cell degranulation
GO:0050731 IEA:Ensembl P positive regulation of peptidyl-tyrosine phosphorylation
GO:0001812 IEA:Ensembl P positive regulation of type I hypersensitivity
GO:0001820 IEA:Ensembl P serotonin secretion

KEGG Pathway Links

KEGG Pathway ID Description
ko05310 Asthma
mcc05310 Asthma
ko04664 Fc epsilon RI signaling pathway
mcc04664 Fc epsilon RI signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR003599 Immunoglobulin subtype
IPR003598 Immunoglobulin subtype 2
IPR007110 Immunoglobulin-like domain
IPR013783 Immunoglobulin-like fold

UniProt Annotations

Entry Information

Gene Name
Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
Protein Entry
F6YWM7_MACMU
UniProt ID
F6YWM7
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014095 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
297280404 RefSeq XP_001117218 260 Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide

Identical Sequences to LMP014095 proteins

Reference Database Accession Length Protein Name
GI:297280404 GenBank EHH50419.1 260 hypothetical protein EGM_01245 [Macaca fascicularis]
GI:297280404 RefSeq XP_005541370.1 260 PREDICTED: high affinity immunoglobulin epsilon receptor subunit alpha [Macaca fascicularis]

Related Sequences to LMP014095 proteins

Reference Database Accession Length Protein Name
GI:297280404 GenBank EHH15395.1 260 hypothetical protein EGK_01475 [Macaca mulatta]
GI:297280404 RefSeq XP_003892939.1 260 PREDICTED: high affinity immunoglobulin epsilon receptor subunit alpha isoform X1 [Papio anubis]