Gene/Proteome Database (LMPD)
Proteins
myelin P2 protein | |
---|---|
Refseq ID | NP_001253234 |
Protein GI | 388453183 |
UniProt ID | F7GMK1 |
mRNA ID | NM_001266305 |
Length | 132 |
Protein sequence is identical to GI:109086785 (mRNA isoform) |
Refseq ID | XP_001092015 |
Protein GI | 109086785 |
UniProt ID | F7GMK1 |
mRNA ID | XM_001092015 |
Length | 132 |
MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKAKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVVECKMKGVVCTRIYEKV |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0015485 | IEA:Ensembl | F | cholesterol binding |
GO:0005504 | IEA:Ensembl | F | fatty acid binding |
GO:0005215 | IEA:InterPro | F | transporter activity |
GO:0061024 | IEA:Ensembl | P | membrane organization |
Domain Information
UniProt Annotations
Entry Information
Gene Name
peripheral myelin protein 2
Protein Entry
F7GMK1_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014641 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109086785 | RefSeq | XP_001092015 | 132 | peripheral myelin protein 2 |
Identical Sequences to LMP014641 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:388453183 | GenBank | EHH64259.1 | 132 | Myelin P2 protein [Macaca fascicularis] |
GI:388453183 | GenBank | AFE78791.1 | 132 | myelin P2 protein [Macaca mulatta] |
GI:388453183 | RefSeq | NP_001272238.1 | 132 | uncharacterized protein LOC101925620 [Macaca fascicularis] |
GI:388453183 | RefSeq | XP_007999159.1 | 132 | PREDICTED: myelin P2 protein [Chlorocebus sabaeus] |
Related Sequences to LMP014641 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:388453183 | DBBJ | BAE91065.1 | 132 | unnamed protein product [Macaca fascicularis] |
GI:388453183 | GenBank | EHH28602.1 | 132 | Myelin P2 protein [Macaca mulatta] |