Gene/Proteome Database (LMPD)

LMPD ID
LMP014641
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
peripheral myelin protein 2
Gene Symbol
Alternate Names
myelin P2 protein;
Chromosome
8
Map Location
chromosome:8

Proteins

myelin P2 protein
Refseq ID NP_001253234
Protein GI 388453183
UniProt ID F7GMK1
mRNA ID NM_001266305
Length 132
Protein sequence is identical to GI:109086785 (mRNA isoform)
Refseq ID XP_001092015
Protein GI 109086785
UniProt ID F7GMK1
mRNA ID XM_001092015
Length 132
MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKAKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVVECKMKGVVCTRIYEKV

Gene Information

Entrez Gene ID
Gene Name
peripheral myelin protein 2
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0015485 IEA:Ensembl F cholesterol binding
GO:0005504 IEA:Ensembl F fatty acid binding
GO:0005215 IEA:InterPro F transporter activity
GO:0061024 IEA:Ensembl P membrane organization

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
peripheral myelin protein 2
Protein Entry
F7GMK1_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014641 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109086785 RefSeq XP_001092015 132 peripheral myelin protein 2

Identical Sequences to LMP014641 proteins

Reference Database Accession Length Protein Name
GI:388453183 GenBank EHH64259.1 132 Myelin P2 protein [Macaca fascicularis]
GI:388453183 GenBank AFE78791.1 132 myelin P2 protein [Macaca mulatta]
GI:388453183 RefSeq NP_001272238.1 132 uncharacterized protein LOC101925620 [Macaca fascicularis]
GI:388453183 RefSeq XP_007999159.1 132 PREDICTED: myelin P2 protein [Chlorocebus sabaeus]

Related Sequences to LMP014641 proteins

Reference Database Accession Length Protein Name
GI:388453183 DBBJ BAE91065.1 132 unnamed protein product [Macaca fascicularis]
GI:388453183 GenBank EHH28602.1 132 Myelin P2 protein [Macaca mulatta]