Gene/Proteome Database (LMPD)

LMPD ID
LMP014695
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
protein kinase C, epsilon
Gene Symbol
Alternate Names
protein kinase C epsilon type;
Chromosome
13
Map Location
chromosome:13
EC Number
2.7.11.13

Proteins

protein kinase C epsilon type
Refseq ID NP_001244670
Protein GI 383873051
UniProt ID F7BIC2
mRNA ID NM_001257741
Length 736
Protein sequence is identical to GI:109102817 (mRNA isoform)
Refseq ID XP_001112763
Protein GI 109102817
UniProt ID F7BIC2
mRNA ID XM_001112763
Length 736
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRSASSPDGQLSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP

Gene Information

Entrez Gene ID
Gene Name
protein kinase C, epsilon
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:Ensembl C Golgi apparatus
GO:0005829 IEA:Ensembl C cytosol
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0005739 IEA:Ensembl C mitochondrion
GO:0005634 IEA:Ensembl C nucleus
GO:0048471 IEA:Ensembl C perinuclear region of cytoplasm
GO:0005886 IEA:Ensembl C plasma membrane
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0004699 IEA:Ensembl F calcium-independent protein kinase C activity
GO:0008047 IEA:Ensembl F enzyme activator activity
GO:0035276 IEA:Ensembl F ethanol binding
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0030546 IEA:Ensembl F receptor activator activity
GO:0035669 IEA:Ensembl P TRAM-dependent toll-like receptor 4 signaling pathway
GO:0071361 IEA:Ensembl P cellular response to ethanol
GO:0071456 IEA:Ensembl P cellular response to hypoxia
GO:0035556 IEA:InterPro P intracellular signal transduction
GO:0031663 IEA:Ensembl P lipopolysaccharide-mediated signaling pathway
GO:0035641 IEA:Ensembl P locomotory exploration behavior
GO:0002281 IEA:Ensembl P macrophage activation involved in immune response
GO:0043123 IEA:Ensembl P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043410 IEA:Ensembl P positive regulation of MAPK cascade
GO:0030838 IEA:Ensembl P positive regulation of actin filament polymerization
GO:0010811 IEA:Ensembl P positive regulation of cell-substrate adhesion
GO:2001031 IEA:Ensembl P positive regulation of cellular glucuronidation
GO:0032467 IEA:Ensembl P positive regulation of cytokinesis
GO:0010634 IEA:Ensembl P positive regulation of epithelial cell migration
GO:0010763 IEA:Ensembl P positive regulation of fibroblast migration
GO:0032024 IEA:Ensembl P positive regulation of insulin secretion
GO:0050996 IEA:Ensembl P positive regulation of lipid catabolic process
GO:0070257 IEA:Ensembl P positive regulation of mucus secretion
GO:0032230 IEA:Ensembl P positive regulation of synaptic transmission, GABAergic
GO:0090303 IEA:Ensembl P positive regulation of wound healing
GO:0061178 IEA:Ensembl P regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0050730 IEA:Ensembl P regulation of peptidyl-tyrosine phosphorylation
GO:0051209 IEA:Ensembl P release of sequestered calcium ion into cytosol
GO:0043278 IEA:Ensembl P response to morphine

KEGG Pathway Links

KEGG Pathway ID Description
ko04666 Fc gamma R-mediated phagocytosis
mcc04666 Fc gamma R-mediated phagocytosis
ko04750 Inflammatory mediator regulation of TRP channels
mcc04750 Inflammatory mediator regulation of TRP channels
ko05206 MicroRNAs in cancer
mcc05206 MicroRNAs in cancer
ko04530 Tight junction
mcc04530 Tight junction
ko04930 Type II diabetes mellitus
mcc04930 Type II diabetes mellitus
ko04270 Vascular smooth muscle contraction
mcc04270 Vascular smooth muscle contraction
ko04022 cGMP-PKG signaling pathway
mcc04022 cGMP-PKG signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR000961 AGC-kinase, C-terminal
IPR000008 C2 domain
IPR020454 Diacylglycerol/phorbol-ester binding
IPR014376 Protein kinase C, delta/epsilon/eta/theta types
IPR002219 Protein kinase C-like, phorbol ester/diacylglycerol-binding domain
IPR000719 Protein kinase domain
IPR017441 Protein kinase, ATP binding site
IPR017892 Protein kinase, C-terminal
IPR011009 Protein kinase-like domain
IPR008271 Serine/threonine-protein kinase, active site
IPR002290 Serine/threonine/dual specificity protein kinase, catalytic domain

UniProt Annotations

Entry Information

Gene Name
protein kinase C, epsilon
Protein Entry
F7BIC2_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Catalytic Activity ATP + a protein = ADP + a phosphoprotein.
Similarity Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
Similarity Contains 1 C2 domain.
Similarity Contains AGC-kinase C-terminal domain.
Similarity Contains protein kinase domain.

Identical and Related Proteins

Unique RefSeq proteins for LMP014695 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109102817 RefSeq XP_001112763 736 protein kinase C, epsilon

Identical Sequences to LMP014695 proteins

Reference Database Accession Length Protein Name
GI:383873051 GenBank EHH55543.1 736 hypothetical protein EGM_04773 [Macaca fascicularis]
GI:383873051 GenBank AFE79190.1 736 protein kinase C epsilon type [Macaca mulatta]
GI:383873051 RefSeq XP_005576025.1 736 PREDICTED: protein kinase C epsilon type isoform X1 [Macaca fascicularis]
GI:383873051 RefSeq XP_007968950.1 736 PREDICTED: protein kinase C epsilon type [Chlorocebus sabaeus]

Related Sequences to LMP014695 proteins

Reference Database Accession Length Protein Name
GI:383873051 GenBank EHH22097.1 736 hypothetical protein EGK_05295 [Macaca mulatta]