Gene/Proteome Database (LMPD)
Proteins
synaptophysin | |
---|---|
Refseq ID | NP_001181258 |
Protein GI | 302563979 |
UniProt ID | F6VGB3 |
mRNA ID | NM_001194329 |
Length | 313 |
Protein sequence is identical to GI:297303856 (mRNA isoform) |
Refseq ID | XP_001106095 |
Protein GI | 297303856 |
UniProt ID | F6VGB3 |
mRNA ID | XM_001106095 |
Length | 313 |
MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGGGGGGYGPQGDYGQQGYGPQGAPTSFSNQM |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0060076 | IEA:Ensembl | C | excitatory synapse |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0044306 | IEA:Ensembl | C | neuron projection terminus |
GO:0048786 | IEA:Ensembl | C | presynaptic active zone |
GO:0042734 | IEA:Ensembl | C | presynaptic membrane |
GO:0030672 | IEA:Ensembl | C | synaptic vesicle membrane |
GO:0015485 | IEA:Ensembl | F | cholesterol binding |
GO:0005215 | IEA:InterPro | F | transporter activity |
GO:0071310 | IEA:Ensembl | P | cellular response to organic substance |
GO:0048169 | IEA:Ensembl | P | regulation of long-term neuronal synaptic plasticity |
GO:0048172 | IEA:Ensembl | P | regulation of short-term neuronal synaptic plasticity |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP014953 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
297303856 | RefSeq | XP_001106095 | 313 | synaptophysin |
Identical Sequences to LMP014953 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:302563979 | GenBank | AFJ72125.1 | 313 | synaptophysin [Macaca mulatta] |
GI:302563979 | RefSeq | XP_003917749.1 | 313 | PREDICTED: synaptophysin [Papio anubis] |
GI:302563979 | RefSeq | XP_005593601.1 | 313 | PREDICTED: synaptophysin [Macaca fascicularis] |
GI:302563979 | RefSeq | XP_010360911.1 | 313 | PREDICTED: synaptophysin [Rhinopithecus roxellana] |
Related Sequences to LMP014953 proteins
Reference | Database | Accession | Length | Protein Name |
---|